PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV53363.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family SRS
Protein Properties Length: 183aa    MW: 19752 Da    PI: 8.3431
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV53363.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70286.37.1e-272089576
      DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkr 76
                 ++C+dCGnqakkdC++ RCRtCCk+rg++C+thvkstWvpa+ r  +  + aa  + + +  +  ++kr+r
  KZV53363.1 20 CSKCHDCGNQAKKDCSYLRCRTCCKNRGYKCHTHVKSTWVPASLRHIQPPMSAA--HGKHHPPHGPNPKRHR 89
                579***************************************998764333333..3333333555555555 PP

2DUF70270.16.9e-229014797154
      DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 + +    ++P+ev+ +a frcv v+s+d+  +e+aYqt+v igGhvf GiLyd+G+e+
  KZV53363.1  90 QISALEDKFPSEVNFPAAFRCVGVRSMDNVVDEYAYQTSVRIGGHVFTGILYDRGPES 147
                 44445567************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.2E-4421146IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.9E-242263IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.6E-1997145IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MMMSGEEARE TVSGGSSSSC SKCHDCGNQA KKDCSYLRCR TCCKNRGYKC HTHVKSTWVP  60
ASLRHIQPPM SAAHGKHHPP HGPNPKRHRQ ISALEDKFPS EVNFPAAFRC VGVRSMDNVV  120
DEYAYQTSVR IGGHVFTGIL YDRGPESEGN GNHVTGESSS ATSGGLSHQP TTSTTAMATT  180
TDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092834.11e-57PREDICTED: protein SHI RELATED SEQUENCE 3-like
SwissprotQ9SD405e-39SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLK4B3M74e-53K4B3M7_SOLLC; Uncharacterized protein
STRINGSolyc01g110140.2.11e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.14e-39SHI-related sequence3